SCOP 1.67: Domain d1n0xh1: 1n0x H:1-113

Lineage for d1n0xh1 (1n0x H:1-113)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Human (Homo sapiens), cluster 1 [TaxId:9606] [88544] (16 PDB entries)

8. Domain d1n0xh1: 1n0x H:1-113 [91528]
   Other proteins in same PDB: d1n0xh2, d1n0xk2, d1n0xl1, d1n0xl2, d1n0xm1, d1n0xm2

Details for d1n0xh1

PDB Entry: 1n0x, 1.8 Å

PDB Description: crystal structure of a broadly neutralizing anti-hiv-1 antibody in complex with a peptide mimotope

SCOP Domain Sequences for d1n0xh1:

Sequence; same for both SEQRES and ATOM records:

>d1n0xh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1}
qvqlvqsgaevkkpgasvkvscqasgyrfsnfvihwvrqapgqrfewmgwinpyngnkef
sakfqdrvtftadtsantaymelrslrsadtavyycarvgpyswddspqdnyymdvwgkg
ttvivss

Timeline for d1n0xh1:

• d1n0xh1 is new in SCOP 1.67
  
• d1n0xh1 appears in SCOP 1.69
  
• d1n0xh1 appears in the current release, SCOPe 2.08