Lineage for d1mzwa_ (1mzw A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2073956Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 2073957Superfamily b.62.1: Cyclophilin-like [50891] (5 families) (S)
  5. 2073958Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
    automatically mapped to Pfam PF00160
  6. 2073959Protein Cyclophilin (eukaryotic) [50893] (13 species)
  7. 2073971Species Human (Homo sapiens), U4/U6 snRNP-specific cyclophilin snucyp-20 [TaxId:9606] [50896] (2 PDB entries)
  8. 2073973Domain d1mzwa_: 1mzw A: [91503]
    complexed with a 30-residue peptide from U4/U6 snRNP 60kda protein, chain B

Details for d1mzwa_

PDB Entry: 1mzw (more details), 2 Å

PDB Description: Crystal structure of a U4/U6 snRNP complex between human spliceosomal cyclophilin H and a U4/U6-60K peptide
PDB Compounds: (A:) U-snRNP-associated cyclophilin

SCOPe Domain Sequences for d1mzwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mzwa_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Homo sapiens), U4/U6 snRNP-specific cyclophilin snucyp-20 [TaxId: 9606]}
nsspvnpvvffdvsiggqevgrmkielfadvvpktaenfrqfctgefrkdgvpigykgst
fhrvikdfmiqggdfvngdgtgvasiyrgpfadenfklrhsapgllsmansgpstngcqf
fitcskcdwldgkhvvfgkiidgllvmrkienvptgpnnkpklpvvisqcgem

SCOPe Domain Coordinates for d1mzwa_:

Click to download the PDB-style file with coordinates for d1mzwa_.
(The format of our PDB-style files is described here.)

Timeline for d1mzwa_: