SCOP 1.69: Domain d1mvua_: 1mvu A:

Lineage for d1mvua_ (1mvu A:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 1.2 [TaxId:10090] [88525] (34 PDB entries)

8. Domain d1mvua_: 1mvu A: [91474]
   Other proteins in same PDB: d1mvub_
   part of P-glycoprotein-specific scFv C219; complexed with synthetic epitope peptide, chain P

Details for d1mvua_

PDB Entry: 1mvu, 1.78 Å

PDB Description: single chain fv of c219 heavy chain v101l mutant in complex with synthetic epitope peptide

SCOP Domain Sequences for d1mvua_:

Sequence; same for both SEQRES and ATOM records:

>d1mvua_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.2}
divmtqspssltvtagekvtmsckssqsllnsgnqknyltwyqqkpgqppklliywastr
esgvpdrftgsgsgtdftltissvqaedlavyycqndysypltfgagtklep

Timeline for d1mvua_:

• d1mvua_ first appeared in SCOP 1.67
  
• d1mvua_ appears in SCOP 1.71
  
• d1mvua_ appears in the current release, SCOPe 2.08