SCOP 1.73: Domain d1mv5b_: 1mv5 B:

Lineage for d1mv5b_ (1mv5 B:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.12: ABC transporter ATPase domain-like [52686] (20 proteins)
   there are two additional subdomains inserted into the central core that has a RecA-like topology

6. Protein Multidrug resistance ABC transporter LmrA, C-terminal domain [102381] (1 species)

7. Species Lactococcus lactis [TaxId:1358] [102382] (1 PDB entry)

8. Domain d1mv5b_: 1mv5 B: [91470]

Details for d1mv5b_

PDB Entry: 1mv5, 3.1 Å

PDB Description: crystal structure of lmra atp-binding domain

PDB Compounds: (B:) Multidrug resistance ABC transporter ATP-binding and permease protein

SCOP Domain Sequences for d1mv5b_:

Sequence; same for both SEQRES and ATOM records:

>d1mv5b_ c.37.1.12 (B:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]}
mlsarhvdfayddseqilrdisfeaqpnsiiafagpsgggkstifsllerfyqptageit
idgqpidnislenwrsqigfvsqdsaimagtirenltyglegdytdedlwqvldlafars
fvenmpdqlntevgergvkisggqrqrlaiaraflrnpkilmldeatasldsesesmvqk
aldslmkgrttlviahrlstivdadkiyfiekgqitgsgkhnelvathplyakyvseqlt
vg

Timeline for d1mv5b_:

• d1mv5b_ first appeared in SCOP 1.67
  
• d1mv5b_ appears in SCOP 1.71
  
• d1mv5b_ appears in SCOP 1.75
  
• d1mv5b_ appears in the current release, SCOPe 2.08