Lineage for d1mrzb2 (1mrz B:302-458)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2118897Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2118898Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2119196Family c.26.1.3: Adenylyltransferase [52397] (6 proteins)
  6. 2119211Protein FMN adenylyltransferase domain of bifunctional FAD synthetase [102260] (1 species)
  7. 2119212Species Thermotoga maritima [TaxId:2336] [102261] (6 PDB entries)
    Uniprot Q9WZW1
    TM0379
  8. 2119214Domain d1mrzb2: 1mrz B:302-458 [91455]
    Other proteins in same PDB: d1mrza1, d1mrzb1
    complexed with cit

Details for d1mrzb2

PDB Entry: 1mrz (more details), 1.9 Å

PDB Description: crystal structure of a flavin binding protein from thermotoga maritima, tm379
PDB Compounds: (B:) Riboflavin kinase/FMN adenylyltransferase

SCOPe Domain Sequences for d1mrzb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mrzb2 c.26.1.3 (B:302-458) FMN adenylyltransferase domain of bifunctional FAD synthetase {Thermotoga maritima [TaxId: 2336]}
vvsigvfdgvhighqkvlrtmkeiaffrkddsliytisyppeyflpdfpgllmtvesrve
mlsryartvvldffrikdltpegfverylsgvsavvvgrdfrfgknasgnasflrkkgve
vyeiedvvvqgkrvssslirnlvqegrveeipaylgr

SCOPe Domain Coordinates for d1mrzb2:

Click to download the PDB-style file with coordinates for d1mrzb2.
(The format of our PDB-style files is described here.)

Timeline for d1mrzb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mrzb1