Lineage for d1mrzb1 (1mrz B:459-589)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2062589Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2063433Superfamily b.43.5: Riboflavin kinase-like [82114] (3 families) (S)
  5. 2063434Family b.43.5.1: ATP-dependent riboflavin kinase-like [82115] (2 proteins)
    automatically mapped to Pfam PF01687
  6. 2063450Protein Riboflavin kinase domain of bifunctional FAD synthetase [101786] (1 species)
  7. 2063451Species Thermotoga maritima [TaxId:2336] [101787] (6 PDB entries)
    Uniprot Q9WZW1
    TM0379
  8. 2063453Domain d1mrzb1: 1mrz B:459-589 [91454]
    Other proteins in same PDB: d1mrza2, d1mrzb2
    complexed with cit

Details for d1mrzb1

PDB Entry: 1mrz (more details), 1.9 Å

PDB Description: crystal structure of a flavin binding protein from thermotoga maritima, tm379
PDB Compounds: (B:) Riboflavin kinase/FMN adenylyltransferase

SCOPe Domain Sequences for d1mrzb1:

Sequence, based on SEQRES records: (download)

>d1mrzb1 b.43.5.1 (B:459-589) Riboflavin kinase domain of bifunctional FAD synthetase {Thermotoga maritima [TaxId: 2336]}
yfeiegivhkdrefgrklgfptanidrgneklvdlkrgvylvrvhlpdgkkkfgvmnvgf
rptvgdarnvkyevyildfegdlygqrlklevlkfmrdekkfdsieelkaaidqdvksar
nmiddiinskf

Sequence, based on observed residues (ATOM records): (download)

>d1mrzb1 b.43.5.1 (B:459-589) Riboflavin kinase domain of bifunctional FAD synthetase {Thermotoga maritima [TaxId: 2336]}
yfeiegivhfptanidrgneklvdlkrgvylvrvhlpdgkkkfgvmnvgfnvkyevyild
fegdlygqrlklevlkfmrdekkfdsieelkaaidqdvksarnmiddiinskf

SCOPe Domain Coordinates for d1mrzb1:

Click to download the PDB-style file with coordinates for d1mrzb1.
(The format of our PDB-style files is described here.)

Timeline for d1mrzb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mrzb2