Lineage for d1mr9x_ (1mr9 X:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2813832Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2813833Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 2813893Family b.81.1.3: Galactoside acetyltransferase-like [51168] (4 proteins)
    this is a repeat family; one repeat unit is 1kqa A:80-100 found in domain
  6. 2813913Protein Xenobiotic acetyltransferase [51169] (2 species)
  7. 2813914Species Enterococcus faecium, VAT(D) [TaxId:1352] [69344] (8 PDB entries)
    streptogramin A acetyltransferase
  8. 2813954Domain d1mr9x_: 1mr9 X: [91439]
    complexed with aco

Details for d1mr9x_

PDB Entry: 1mr9 (more details), 3 Å

PDB Description: Crystal structure of Streptogramin A Acetyltransferase with acetyl-CoA bound
PDB Compounds: (X:) streptogramin a acetyltransferase

SCOPe Domain Sequences for d1mr9x_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mr9x_ b.81.1.3 (X:) Xenobiotic acetyltransferase {Enterococcus faecium, VAT(D) [TaxId: 1352]}
mgpnpmkmypiegnksvqfikpileklenvevgeysyydskngetfdkqilyhypilndk
lkigkfcsigpgvtiimnganhrmdgstypfnlfgngwekhmpkldqlpikgdtiigndv
wigkdvvimpgvkigdgaivaansvvvkdiapymlaggnpaneikqrfdqdtinqlldik
wwnwpidiinenidkildnsiir

SCOPe Domain Coordinates for d1mr9x_:

Click to download the PDB-style file with coordinates for d1mr9x_.
(The format of our PDB-style files is described here.)

Timeline for d1mr9x_: