SCOP 1.69: Domain d1mqta_: 1mqt A:

Lineage for d1mqta_ (1mqt A:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (8 families)

5. Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (9 proteins)
   the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
   there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)

6. Protein Swine vesicular disease virus coat proteins [89225] (1 species)

7. Species Swine vesicular disease virus [TaxId:12075] [89226] (2 PDB entries)

8. Domain d1mqta_: 1mqt A: [91425]

Details for d1mqta_

PDB Entry: 1mqt, 3.3 Å

PDB Description: Swine Vesicular Disease Virus coat protein

SCOP Domain Sequences for d1mqta_:

Sequence; same for both SEQRES and ATOM records:

>d1mqta_ b.121.4.1 (A:) Swine vesicular disease virus coat proteins {Swine vesicular disease virus}
rvadtvgsgpvnsesipaltaaetghtsqvvpsdtmqtrhvknyhsrsestvenflcrsa
cvfyttyknhdsdgdnfaywvinarqvaqlrrklemftyarfdleltfvitstqeqsttq
gqdtpvlthqimyvppggpvptkvnsyswqtstnpsvfwtegnapprmsipfigignays
mfydgwarfdkqgtygistlnsmgtlymrhvngggpgpivstvriyfkpkhvktwvprpp
rlcqykkagnvnfiptsvtegrtdittmktt

Timeline for d1mqta_:

• d1mqta_ first appeared in SCOP 1.67
  
• d1mqta_ appears in SCOP 1.71
  
• d1mqta_ appears in the current release, SCOPe 2.08