Lineage for d1mqpa2 (1mqp A:3-142)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2570195Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2571709Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (4 families) (S)
    contains similar fold but lacks its catalytic centre
  5. 2571759Family d.92.2.2: alpha-D-glucuronidase, N-terminal domain [82737] (1 protein)
    family GH67
    automatically mapped to Pfam PF03648
  6. 2571760Protein alpha-D-glucuronidase, N-terminal domain [82738] (2 species)
    inverting reaction mechanism
  7. 2571761Species Bacillus stearothermophilus [TaxId:1422] [82740] (7 PDB entries)
  8. 2571767Domain d1mqpa2: 1mqp A:3-142 [91419]
    Other proteins in same PDB: d1mqpa1
    complexed with gol

Details for d1mqpa2

PDB Entry: 1mqp (more details), 1.9 Å

PDB Description: the crystal structure of alpha-d-glucuronidase from bacillus stearothermophilus t-6
PDB Compounds: (A:) alpha-d-glucuronidase

SCOPe Domain Sequences for d1mqpa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mqpa2 d.92.2.2 (A:3-142) alpha-D-glucuronidase, N-terminal domain {Bacillus stearothermophilus [TaxId: 1422]}
agyepcwlryerkdqysrlrfeeivakrtspifqavveelqkglrsmmeiepqvvqevne
tansiwlgtledeeferplegtlvhpegyvirsdvddgpfriyiigktdagvlygvfhfl
rllqmgeniaqlsiieqpkn

SCOPe Domain Coordinates for d1mqpa2:

Click to download the PDB-style file with coordinates for d1mqpa2.
(The format of our PDB-style files is described here.)

Timeline for d1mqpa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mqpa1