Lineage for d1mqmb_ (1mqm B:)

  1. Root: SCOP 1.67
  2. 431023Class h: Coiled coil proteins [57942] (6 folds)
  3. 431801Fold h.3: Stalk segment of viral fusion proteins [58063] (2 superfamilies)
    core: trimeric coiled coil
  4. 431802Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (1 family) (S)
  5. 431803Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (1 protein)
  6. 431804Protein Influenza hemagglutinin (stalk) [58066] (2 species)
    trimer
  7. 431805Species Influenza A virus, different strains [TaxId:11320] [58067] (35 PDB entries)
  8. 431855Domain d1mqmb_: 1mqm B: [91407]
    Other proteins in same PDB: d1mqma_, d1mqmd_, d1mqmg_

Details for d1mqmb_

PDB Entry: 1mqm (more details), 2.6 Å

PDB Description: bha/lsta

SCOP Domain Sequences for d1mqmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mqmb_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains}
glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqinrklnrviektn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidladsemnklfe
ktrrqlrenaedmgngcfkiyhkcdnaciesirngtydhdiyrdealnnrfq

SCOP Domain Coordinates for d1mqmb_:

Click to download the PDB-style file with coordinates for d1mqmb_.
(The format of our PDB-style files is described here.)

Timeline for d1mqmb_: