SCOPe 2.08: Domain d1mqgb_: 1mqg B:

Lineage for d1mqgb_ (1mqg B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
   has additional insertions and/or extensions that are not grouped together
   

6. Protein Glutamate receptor ligand binding core [53881] (5 species)

7. Species Norway rat (Rattus norvegicus), GluR2 [TaxId:10116] [53882] (158 PDB entries)

8. Domain d1mqgb_: 1mqg B: [91396]
   complexed with gol, iwd, so4

Details for d1mqgb_

PDB Entry: 1mqg, 2.15 Å

PDB Description: crystal structure of the glur2 ligand binding core (s1s2j) in complex with iodo-willardiine at 2.15 angstroms resolution

PDB Compounds: (B:) Glutamate receptor 2

SCOPe Domain Sequences for d1mqgb_:

Sequence; same for both SEQRES and ATOM records:

>d1mqgb_ c.94.1.1 (B:) Glutamate receptor ligand binding core {Norway rat (Rattus norvegicus), GluR2 [TaxId: 10116]}
nktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyg
ardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpie
saedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvr
kskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlkln
eqglldklknkwwydkgecg

Timeline for d1mqgb_:

• d1mqgb_ first appeared in SCOP 1.67
  
• d1mqgb_ appears in SCOPe 2.07