Class g: Small proteins [56992] (90 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (7 families) |
Family g.3.11.1: EGF-type module [57197] (22 proteins) |
Protein Transforming growth factor alpha [57217] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [57218] (6 PDB entries) |
Domain d1moxd_: 1mox D: [91381] Other proteins in same PDB: d1moxa1, d1moxa2, d1moxa3, d1moxa4, d1moxb1, d1moxb2, d1moxb3, d1moxb4 complexed with EGF receptor complexed with cd, cl, fuc, man, nag, pt |
PDB Entry: 1mox (more details), 2.5 Å
SCOP Domain Sequences for d1moxd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1moxd_ g.3.11.1 (D:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} shfndcpdshtqfcfhgtcrflvqedkpacvchsgyvgarcehadlla
Timeline for d1moxd_: