Lineage for d1moxd_ (1mox D:)

  1. Root: SCOP 1.69
  2. 520835Class g: Small proteins [56992] (75 folds)
  3. 521093Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 521739Superfamily g.3.11: EGF/Laminin [57196] (6 families) (S)
  5. 521740Family g.3.11.1: EGF-type module [57197] (21 proteins)
  6. 522006Protein Transforming growth factor alpha [57217] (1 species)
  7. 522007Species Human (Homo sapiens) [TaxId:9606] [57218] (6 PDB entries)
  8. 522009Domain d1moxd_: 1mox D: [91381]
    Other proteins in same PDB: d1moxa1, d1moxa2, d1moxa3, d1moxa4, d1moxb1, d1moxb2, d1moxb3, d1moxb4
    complexed with EGF receptor

Details for d1moxd_

PDB Entry: 1mox (more details), 2.5 Å

PDB Description: crystal structure of human epidermal growth factor receptor (residues 1-501) in complex with tgf-alpha

SCOP Domain Sequences for d1moxd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1moxd_ g.3.11.1 (D:) Transforming growth factor alpha {Human (Homo sapiens)}
shfndcpdshtqfcfhgtcrflvqedkpacvchsgyvgarcehadlla

SCOP Domain Coordinates for d1moxd_:

Click to download the PDB-style file with coordinates for d1moxd_.
(The format of our PDB-style files is described here.)

Timeline for d1moxd_: