Lineage for d1moxb3 (1mox B:163-311)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029893Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 3030968Superfamily g.3.9: Growth factor receptor domain [57184] (2 families) (S)
  5. 3030969Family g.3.9.1: Growth factor receptor domain [57185] (11 proteins)
    Pfam PF00757; Pfam PF14843; Pfam PF15913
    heterogeneous fold; applies to domains that adopt a different fold than the exemplar domain but has similar sequence and number of secondary structures
  6. Protein EGF receptor Cys-rich domains, N-terminal domain [419056] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [419547] (4 PDB entries)
  8. 3030984Domain d1moxb3: 1mox B:163-311 [91378]
    Other proteins in same PDB: d1moxa1, d1moxa2, d1moxa4, d1moxb1, d1moxb2, d1moxb4, d1moxc_, d1moxd_
    complexed with TGF-alpha
    complexed with cd, cl, nag, pt

Details for d1moxb3

PDB Entry: 1mox (more details), 2.5 Å

PDB Description: crystal structure of human epidermal growth factor receptor (residues 1-501) in complex with tgf-alpha
PDB Compounds: (B:) Epidermal growth factor receptor

SCOPe Domain Sequences for d1moxb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1moxb3 g.3.9.1 (B:163-311) EGF receptor Cys-rich domains, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
cqkcdpscpngscwgageencqkltkiicaqqcsgrcrgkspsdcchnqcaagctgpres
dclvcrkfrdeatckdtcpplmlynpttyqmdvnpegkysfgatcvkkcprnyvvtdhgs
cvracgadsyemeedgvrkckkcegpcrk

SCOPe Domain Coordinates for d1moxb3:

Click to download the PDB-style file with coordinates for d1moxb3.
(The format of our PDB-style files is described here.)

Timeline for d1moxb3: