SCOPe 2.05: Domain d1mojd_: 1moj D:

Lineage for d1mojd_ (1moj D:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.1: Ferritin [47241] (10 proteins)

6. Protein Dodecameric ferritin homolog [47250] (14 species)

7. Species Halobacterium salinarum [TaxId:2242] [101135] (5 PDB entries)
   Uniprot Q9HMP7

8. Domain d1mojd_: 1moj D: [91370]
   complexed with fe, mg, na

Details for d1mojd_

PDB Entry: 1moj, 1.9 Å

PDB Description: Crystal structure of an archaeal dps-homologue from Halobacterium salinarum

PDB Compounds: (D:) Dps-like ferritin

SCOPe Domain Sequences for d1mojd_:

Sequence; same for both SEQRES and ATOM records:

>d1mojd_ a.25.1.1 (D:) Dodecameric ferritin homolog {Halobacterium salinarum [TaxId: 2242]}
aratagevegsdalrmdadraeqcvdalnadlanvyvlyhqlkkhhwnvegaefrdlhlf
lgeaaetaeevadelaervqalggvphaspetlqaeasvdvededvydirtslandmaiy
gdiieatrehtelaenlgdhatahmlreglieleddahhiehyleddtlvtqgal

Timeline for d1mojd_:

• d1mojd_ first appeared in SCOP 1.67
  
• d1mojd_ appears in SCOPe 2.04
  
• d1mojd_ appears in SCOPe 2.06
  
• d1mojd_ appears in the current release, SCOPe 2.08