Lineage for d1mojc_ (1moj C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2314150Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2314151Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2314152Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2314869Protein Dodecameric ferritin homolog [47250] (16 species)
  7. 2315029Species Halobacterium salinarum [TaxId:2242] [101135] (5 PDB entries)
    Uniprot Q9HMP7
  8. 2315032Domain d1mojc_: 1moj C: [91369]
    complexed with fe, mg, na

Details for d1mojc_

PDB Entry: 1moj (more details), 1.9 Å

PDB Description: Crystal structure of an archaeal dps-homologue from Halobacterium salinarum
PDB Compounds: (C:) Dps-like ferritin

SCOPe Domain Sequences for d1mojc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mojc_ a.25.1.1 (C:) Dodecameric ferritin homolog {Halobacterium salinarum [TaxId: 2242]}
aratagevegsdalrmdadraeqcvdalnadlanvyvlyhqlkkhhwnvegaefrdlhlf
lgeaaetaeevadelaervqalggvphaspetlqaeasvdvededvydirtslandmaiy
gdiieatrehtelaenlgdhatahmlreglieleddahhiehyleddtlvtqgal

SCOPe Domain Coordinates for d1mojc_:

Click to download the PDB-style file with coordinates for d1mojc_.
(The format of our PDB-style files is described here.)

Timeline for d1mojc_: