SCOP 1.73: Domain d1mojc_: 1moj C:

Lineage for d1mojc_ (1moj C:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.25: Ferritin-like [47239] (4 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (5 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.1: Ferritin [47241] (9 proteins)

6. Protein Dodecameric ferritin homolog [47250] (13 species)

7. Species Archaeon Halobacterium salinarum [TaxId:2242] [101135] (5 PDB entries)

8. Domain d1mojc_: 1moj C: [91369]

Details for d1mojc_

PDB Entry: 1moj, 1.9 Å

PDB Description: Crystal structure of an archaeal dps-homologue from Halobacterium salinarum

PDB Compounds: (C:) Dps-like ferritin

SCOP Domain Sequences for d1mojc_:

Sequence; same for both SEQRES and ATOM records:

>d1mojc_ a.25.1.1 (C:) Dodecameric ferritin homolog {Archaeon Halobacterium salinarum [TaxId: 2242]}
aratagevegsdalrmdadraeqcvdalnadlanvyvlyhqlkkhhwnvegaefrdlhlf
lgeaaetaeevadelaervqalggvphaspetlqaeasvdvededvydirtslandmaiy
gdiieatrehtelaenlgdhatahmlreglieleddahhiehyleddtlvtqgal

Timeline for d1mojc_:

• d1mojc_ first appeared in SCOP 1.67
  
• d1mojc_ appears in SCOP 1.71
  
• d1mojc_ appears in SCOP 1.75
  
• d1mojc_ appears in the current release, SCOPe 2.08