Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.94: HPr-like [55593] (2 superfamilies) beta-alpha-beta(2)-alpha-beta-alpha; 2 layers: a/b; antiparallel sheet 1423 |
Superfamily d.94.1: HPr-like [55594] (2 families) |
Family d.94.1.1: HPr-like [55595] (3 proteins) automatically mapped to Pfam PF00381 |
Protein Crh, catabolite repression HPr-like protein [69783] (1 species) |
Species Bacillus subtilis [TaxId:1423] [69784] (6 PDB entries) |
Domain d1mo1c1: 1mo1 C:1-85 [91365] Other proteins in same PDB: d1mo1a2, d1mo1b2, d1mo1c2, d1mo1d2 N-terminal strand-swapped dimer complexed with gol, so4 |
PDB Entry: 1mo1 (more details), 1.8 Å
SCOPe Domain Sequences for d1mo1c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mo1c1 d.94.1.1 (C:1-85) Crh, catabolite repression HPr-like protein {Bacillus subtilis [TaxId: 1423]} mvqqkvevrlktglqarpaalfvqeanrftsdvflekdgkkvnaksimglmslavstgte vtliaqgedeqealeklaayvqeev
Timeline for d1mo1c1: