SCOPe 2.07: Domain d1mo1b1: 1mo1 B:1-85

Lineage for d1mo1b1 (1mo1 B:1-85)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.94: HPr-like [55593] (2 superfamilies)
   beta-alpha-beta(2)-alpha-beta-alpha; 2 layers: a/b; antiparallel sheet 1423

4. Superfamily d.94.1: HPr-like [55594] (2 families)

5. Family d.94.1.1: HPr-like [55595] (3 proteins)
   automatically mapped to Pfam PF00381

6. Protein Crh, catabolite repression HPr-like protein [69783] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [69784] (6 PDB entries)

8. Domain d1mo1b1: 1mo1 B:1-85 [91364]
   Other proteins in same PDB: d1mo1a2, d1mo1b2, d1mo1c2, d1mo1d2
   N-terminal strand-swapped dimer
   complexed with gol, so4

Details for d1mo1b1

PDB Entry: 1mo1, 1.8 Å

PDB Description: crystal structure at 1.8 angstroms of seleno methionyled crh, the bacillus subtilis catabolite repression containing protein crh reveals an unexpected swapping domain as an untertwinned dimer

PDB Compounds: (B:) HPr-like protein crh

SCOPe Domain Sequences for d1mo1b1:

Sequence; same for both SEQRES and ATOM records:

>d1mo1b1 d.94.1.1 (B:1-85) Crh, catabolite repression HPr-like protein {Bacillus subtilis [TaxId: 1423]}
mvqqkvevrlktglqarpaalfvqeanrftsdvflekdgkkvnaksimglmslavstgte
vtliaqgedeqealeklaayvqeev

Timeline for d1mo1b1:

• d1mo1b1 first appeared in SCOP 1.67, called d1mo1b_
  
• d1mo1b1 appears in SCOPe 2.06
  
• d1mo1b1 appears in the current release, SCOPe 2.08