Lineage for d1mo1a_ (1mo1 A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1919250Fold d.94: HPr-like [55593] (2 superfamilies)
    beta-alpha-beta(2)-alpha-beta-alpha; 2 layers: a/b; antiparallel sheet 1423
  4. 1919251Superfamily d.94.1: HPr-like [55594] (2 families) (S)
  5. 1919252Family d.94.1.1: HPr-like [55595] (3 proteins)
    automatically mapped to Pfam PF00381
  6. 1919253Protein Crh, catabolite repression HPr-like protein [69783] (1 species)
  7. 1919254Species Bacillus subtilis [TaxId:1423] [69784] (6 PDB entries)
  8. 1919255Domain d1mo1a_: 1mo1 A: [91363]
    N-terminal strand-swapped dimer
    complexed with gol, so4

Details for d1mo1a_

PDB Entry: 1mo1 (more details), 1.8 Å

PDB Description: crystal structure at 1.8 angstroms of seleno methionyled crh, the bacillus subtilis catabolite repression containing protein crh reveals an unexpected swapping domain as an untertwinned dimer
PDB Compounds: (A:) HPr-like protein crh

SCOPe Domain Sequences for d1mo1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mo1a_ d.94.1.1 (A:) Crh, catabolite repression HPr-like protein {Bacillus subtilis [TaxId: 1423]}
mvqqkvevrlktglqarpaalfvqeanrftsdvflekdgkkvnaksimglmslavstgte
vtliaqgedeqealeklaayvqeevlq

SCOPe Domain Coordinates for d1mo1a_:

Click to download the PDB-style file with coordinates for d1mo1a_.
(The format of our PDB-style files is described here.)

Timeline for d1mo1a_: