Lineage for d1mjul1 (1mju L:1-107)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1287435Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1288590Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1288823Species Mouse (Mus musculus), cluster 1.1 [TaxId:10090] [88524] (131 PDB entries)
    Uniprot P01631 #KV2G_MOUSE Ig kappa chain V-II region 26-10; 79% sequence identity ! Uniprot P06310 # KV2F_HUMAN IG KAPPA CHAIN V-II REGION RPMI 6410 PRECURSOR ! Uniprot P03976 # KV2E_MOUSE (P03976) Ig kappa chain V-II region 17S29.1 ! Uniprot P01642 21-115 # ! KV2G_MOUSE IG KAPPA CHAIN V-II REGION 26-10
  8. 1288824Domain d1mjul1: 1mju L:1-107 [91304]
    Other proteins in same PDB: d1mjuh1, d1mjuh2, d1mjul2
    part of the esterolytic Fab ms6-164
    complexed with gol

Details for d1mjul1

PDB Entry: 1mju (more details), 1.22 Å

PDB Description: 1.22 angstrom resolution crystal structure of the fab fragment of esterolytic antibody ms6-12
PDB Compounds: (L:) immunoglobulin ms6-12

SCOPe Domain Sequences for d1mjul1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mjul1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]}
divmtqaapsvpvtpgesvsiscrssksllhsngntylywflqrpgqspqlliyrmsnla
sgvpdrfsgsgsgtaftlrisrveaedvgvyyclqhleypftfgagtklelk

SCOPe Domain Coordinates for d1mjul1:

Click to download the PDB-style file with coordinates for d1mjul1.
(The format of our PDB-style files is described here.)

Timeline for d1mjul1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mjul2