Lineage for d1mjjl1 (1mjj L:1-107)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 546420Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)
  6. 547289Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 547441Species Mouse (Mus musculus), cluster 1.1 [TaxId:10090] [88524] (126 PDB entries)
  8. 547469Domain d1mjjl1: 1mjj L:1-107 [91300]
    Other proteins in same PDB: d1mjja2, d1mjjb1, d1mjjb2, d1mjjh1, d1mjjh2, d1mjjl2
    part of the esterolytic Fab ms6-164
    complexed with hal, so4

Details for d1mjjl1

PDB Entry: 1mjj (more details), 2.1 Å

PDB Description: high resolution crystal structure of the complex of the fab fragment of esterolytic antibody ms6-12 and a transition-state analog

SCOP Domain Sequences for d1mjjl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mjjl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1}
divmtqaapsvpvtpgesvsiscrssksllhsngntylywflqrpgqspqlliyrmsnla
sgvpdrfsgsgsgtaftlrisrveaedvgvyyclqhleypftfgagtklelk

SCOP Domain Coordinates for d1mjjl1:

Click to download the PDB-style file with coordinates for d1mjjl1.
(The format of our PDB-style files is described here.)

Timeline for d1mjjl1: