SCOP 1.73: Domain d1mjja2: 1mjj A:108-213

Lineage for d1mjja2 (1mjj A:108-213)

Root: SCOP 1.73
Class b: All beta proteins [48724] (165 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (4 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
Species Mouse (Mus musculus) [TaxId:10090] [88567] (311 PDB entries)
Domain d1mjja2: 1mjj A:108-213 [91295]
Other proteins in same PDB: d1mjja1, d1mjjb1, d1mjjb2, d1mjjh1, d1mjjh2, d1mjjl1

Details for d1mjja2

PDB Entry: 1mjj (more details), 2.1 Å

PDB Description: high resolution crystal structure of the complex of the fab fragment of esterolytic antibody ms6-12 and a transition-state analog

PDB Compounds: (A:) immunoglobulin ms6-12

SCOP Domain Sequences for d1mjja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mjja2 b.1.1.2 (A:108-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

SCOP Domain Coordinates for d1mjja2:

Click to download the PDB-style file with coordinates for d1mjja2.
(The format of our PDB-style files is described here.)

Timeline for d1mjja2: