SCOP 1.67: Domain d1mj8l2: 1mj8 L:108-214

Lineage for d1mj8l2 (1mj8 L:108-214)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88567] (270 PDB entries)

8. Domain d1mj8l2: 1mj8 L:108-214 [91293]
   Other proteins in same PDB: d1mj8h1, d1mj8h2, d1mj8l1
   part of the esterolytic Fab ms6-164
   complexed with gol, po4

Details for d1mj8l2

PDB Entry: 1mj8, 1.75 Å

PDB Description: High Resolution Crystal Structure Of The Fab Fragment of The Esterolytic Antibody MS6-126

SCOP Domain Sequences for d1mj8l2:

Sequence, based on SEQRES records:

>d1mj8l2 b.1.1.2 (L:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Sequence, based on observed residues (ATOM records):

>d1mj8l2 b.1.1.2 (L:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathpivksfnrnec

Timeline for d1mj8l2:

• d1mj8l2 is new in SCOP 1.67
  
• d1mj8l2 appears in SCOP 1.69
  
• d1mj8l2 appears in the current release, SCOPe 2.08