Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species) VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species |
Species Mouse (Mus musculus), cluster 1.1 [TaxId:10090] [88524] (127 PDB entries) Uniprot P01631 #KV2G_MOUSE Ig kappa chain V-II region 26-10; 79% sequence identity ! Uniprot P06310 # KV2F_HUMAN IG KAPPA CHAIN V-II REGION RPMI 6410 PRECURSOR ! Uniprot P03976 # KV2E_MOUSE (P03976) Ig kappa chain V-II region 17S29.1 ! Uniprot P01642 21-115 # ! KV2G_MOUSE IG KAPPA CHAIN V-II REGION 26-10 |
Domain d1mj7l1: 1mj7 L:1-107 [91288] Other proteins in same PDB: d1mj7h1, d1mj7h2, d1mj7l2 part of the esterolytic Fab ms6-164 complexed with hal |
PDB Entry: 1mj7 (more details), 2.25 Å
SCOPe Domain Sequences for d1mj7l1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mj7l1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]} eivmtqaapsvpvtpgesvsiscrssksllhsngntylnwflqrpgqspqlliyrmsnla sgvpdrfsgsgsetaftlrtsrveaedvgvyycmqhleypftfgsgtklelk
Timeline for d1mj7l1: