Lineage for d1mj7h1 (1mj7 H:4-113)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 929301Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 929498Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 929960Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (152 PDB entries)
    Uniprot P01756 1-117 # 78% sequense identity; HV12_MOUSE Ig heavy chain V region MOPC 104E ! SQ NA # humanized antibody ! Uniprot P01750 # HV06_MOUSE Ig heavy chain V region 102 precursor ! Uniprot P01750 20-116 # ! HV06_MOUSE Ig heavy chain V region 102 precursor
  8. 930026Domain d1mj7h1: 1mj7 H:4-113 [91286]
    Other proteins in same PDB: d1mj7h2, d1mj7l1, d1mj7l2
    part of the esterolytic Fab ms6-164
    complexed with hal

Details for d1mj7h1

PDB Entry: 1mj7 (more details), 2.25 Å

PDB Description: Crystal Structure Of The Complex Of The Fab fragment of Esterolytic Antibody MS5-393 and A Transition-State Analog
PDB Compounds: (H:) immunoglobulin ms5-393

SCOPe Domain Sequences for d1mj7h1:

Sequence, based on SEQRES records: (download)

>d1mj7h1 b.1.1.1 (H:4-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
lqqpgaelvkpgasvklsckasgytftsswinwvkqrpgqglewignvypgssstnynek
fknkatltvdtssstaymqlssltsddsafyycvrkdyswfpywgqgtlvtvsa

Sequence, based on observed residues (ATOM records): (download)

>d1mj7h1 b.1.1.1 (H:4-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
lqqpgaelvkpgasvklscsswinwvkqrpgqglewignvypstnynekfknkatltvdt
ssstaymqlssltsddsafyycvrkdfpywgqgtlvtvsa

SCOPe Domain Coordinates for d1mj7h1:

Click to download the PDB-style file with coordinates for d1mj7h1.
(The format of our PDB-style files is described here.)

Timeline for d1mj7h1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mj7h2