SCOP 1.73: Domain d1mh5h1: 1mh5 H:2-113

Lineage for d1mh5h1 (1mh5 H:2-113)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (148 PDB entries)

8. Domain d1mh5h1: 1mh5 H:2-113 [91270]
   Other proteins in same PDB: d1mh5a1, d1mh5a2, d1mh5b2, d1mh5h2, d1mh5l1, d1mh5l2
   part of the esterolytic Fab ms6-164
   complexed with hal, so4

Details for d1mh5h1

PDB Entry: 1mh5, 2.1 Å

PDB Description: The Structure Of The Complex Of The Fab Fragment Of The Esterolytic Antibody MS6-164 and A Transition-State Analog

PDB Compounds: (H:) immunoglobulin ms6-164

SCOP Domain Sequences for d1mh5h1:

Sequence; same for both SEQRES and ATOM records:

>d1mh5h1 b.1.1.1 (H:2-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
vqlqqpgaelvkpgasvklsckasgytftsnwinwvkqrpgqglewigniypdsyrtnyn
ekfkrkatltvdtssstaymqlssltsddsavyycvrkhysydgvvywgqgtlvtvsa

Timeline for d1mh5h1:

• d1mh5h1 first appeared in SCOP 1.67
  
• d1mh5h1 appears in SCOP 1.71
  
• d1mh5h1 appears in SCOP 1.75
  
• d1mh5h1 appears in the current release, SCOPe 2.08