SCOPe 2.03: Domain d1mh5a2: 1mh5 A:108-210

Lineage for d1mh5a2 (1mh5 A:108-210)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88567] (364 PDB entries)
   Uniprot P01837# KAC_MOUSE Ig kappa chain C region; 99% sequence identity ! SQ NA # natural chimera; best hits are: Uniprot P01637 (Ig kappa chain V-V region T1) and Uniprot P01837 (Ig kappa chain C region) ! Uniprot P01837 # KAC_MOUSE Ig kappa chain C region ! Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01837 # ! KAC_MOUSE Ig kappa chain C region

8. Domain d1mh5a2: 1mh5 A:108-210 [91267]
   Other proteins in same PDB: d1mh5a1, d1mh5b1, d1mh5b2, d1mh5h1, d1mh5h2, d1mh5l1
   part of the esterolytic Fab ms6-164
   complexed with hal, so4

Details for d1mh5a2

PDB Entry: 1mh5, 2.1 Å

PDB Description: The Structure Of The Complex Of The Fab Fragment Of The Esterolytic Antibody MS6-164 and A Transition-State Analog

PDB Compounds: (A:) immunoglobulin ms6-164

SCOPe Domain Sequences for d1mh5a2:

Sequence, based on SEQRES records:

>d1mh5a2 b.1.1.2 (A:108-210) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfn

Sequence, based on observed residues (ATOM records):

>d1mh5a2 b.1.1.2 (A:108-210) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
stltltkrhnsytceatspivksfn

Timeline for d1mh5a2:

• d1mh5a2 first appeared in SCOP 1.67
  
• d1mh5a2 appears in SCOPe 2.02
  
• d1mh5a2 appears in SCOPe 2.04
  
• d1mh5a2 appears in the current release, SCOPe 2.08