Lineage for d1mh5a2 (1mh5 A:108-210)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655938Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 656129Species Mouse (Mus musculus) [TaxId:10090] [88567] (311 PDB entries)
  8. 656240Domain d1mh5a2: 1mh5 A:108-210 [91267]
    Other proteins in same PDB: d1mh5a1, d1mh5b1, d1mh5b2, d1mh5h1, d1mh5h2, d1mh5l1

Details for d1mh5a2

PDB Entry: 1mh5 (more details), 2.1 Å

PDB Description: The Structure Of The Complex Of The Fab Fragment Of The Esterolytic Antibody MS6-164 and A Transition-State Analog
PDB Compounds: (A:) immunoglobulin ms6-164

SCOP Domain Sequences for d1mh5a2:

Sequence, based on SEQRES records: (download)

>d1mh5a2 b.1.1.2 (A:108-210) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfn

Sequence, based on observed residues (ATOM records): (download)

>d1mh5a2 b.1.1.2 (A:108-210) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
stltltkrhnsytceatspivksfn

SCOP Domain Coordinates for d1mh5a2:

Click to download the PDB-style file with coordinates for d1mh5a2.
(The format of our PDB-style files is described here.)

Timeline for d1mh5a2: