SCOP 1.69: Domain d1mexh2: 1mex H:114-226

Lineage for d1mexh2 (1mex H:114-226)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (295 PDB entries)

8. Domain d1mexh2: 1mex H:114-226 [91258]
   Other proteins in same PDB: d1mexh1, d1mexl1, d1mexl2
   part of Fab 29g12

Details for d1mexh2

PDB Entry: 1mex, 1.25 Å

PDB Description: Antibody Catalysis of a Bimolecular Cycloaddition Reaction

SCOP Domain Sequences for d1mexh2:

Sequence, based on SEQRES records:

>d1mexh2 b.1.1.2 (H:114-226) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
ggttppsvyplapgsaaqaatnsvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqs
dlytlsssvtvpsstwpsqsvtcnvahpasstavdkkiapa

Sequence, based on observed residues (ATOM records):

>d1mexh2 b.1.1.2 (H:114-226) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
ggttppsvyplapgsaaqtnsvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl
ytlsssvtvpsstwpsqsvtcnvahpasstavdkkiapa

Timeline for d1mexh2:

• d1mexh2 first appeared in SCOP 1.67
  
• d1mexh2 appears in SCOP 1.71
  
• d1mexh2 appears in the current release, SCOPe 2.08