SCOPe 2.02: Domain d1mepd_: 1mep D:

Lineage for d1mepd_ (1mep D:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)

6. Protein Streptavidin [50878] (1 species)

7. Species Streptomyces avidinii [TaxId:1895] [50879] (120 PDB entries)

8. Domain d1mepd_: 1mep D: [91255]
   complexed with btn; mutant

Details for d1mepd_

PDB Entry: 1mep, 1.65 Å

PDB Description: crystal structure of streptavidin double mutant s45a/d128a with biotin: cooperative hydrogen-bond interactions in the streptavidin- biotin system.

PDB Compounds: (D:) streptavidin

SCOPe Domain Sequences for d1mepd_:

Sequence; same for both SEQRES and ATOM records:

>d1mepd_ b.61.1.1 (D:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
gitgtwynqlgstfivtagadgaltgtyeaavgnaesryvltgrydsapatdgsgtalgw
tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghatftkv

Timeline for d1mepd_:

• d1mepd_ first appeared in SCOP 1.67
  
• d1mepd_ appears in SCOPe 2.01
  
• d1mepd_ appears in SCOPe 2.03
  
• d1mepd_ appears in the current release, SCOPe 2.08