SCOPe 2.02: Domain d1md8a2: 1md8 A:358-433

Lineage for d1md8a2 (1md8 A:358-433)

1. Root: SCOPe 2.02

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
   disulfide-rich all-beta fold

4. Superfamily g.18.1: Complement control module/SCR domain [57535] (1 family)

5. Family g.18.1.1: Complement control module/SCR domain [57536] (14 proteins)
   Pfam PF00084

6. Protein Complement C1R protease domains [75682] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [75683] (3 PDB entries)

8. Domain d1md8a2: 1md8 A:358-433 [91246]
   Other proteins in same PDB: d1md8a1

Details for d1md8a2

PDB Entry: 1md8, 2.8 Å

PDB Description: Monomeric structure of the active catalytic domain of complement protease C1r

PDB Compounds: (A:) c1r complement serine protease

SCOPe Domain Sequences for d1md8a2:

Sequence, based on SEQRES records:

>d1md8a2 g.18.1.1 (A:358-433) Complement C1R protease domains {Human (Homo sapiens) [TaxId: 9606]}
dcgqprnlpngdfrytttmgvntykariqyychepyykmqtragsreseqgvytctaqgi
wkneqkgekiprclpv

Sequence, based on observed residues (ATOM records):

>d1md8a2 g.18.1.1 (A:358-433) Complement C1R protease domains {Human (Homo sapiens) [TaxId: 9606]}
dcgqprnlpngdfrytttmgvntykariqyychepyykmqtqgvytctaqgiwkneqkge
kiprclpv

Timeline for d1md8a2:

• d1md8a2 first appeared in SCOP 1.67
  
• d1md8a2 appears in SCOPe 2.01
  
• d1md8a2 appears in SCOPe 2.03
  
• d1md8a2 appears in the current release, SCOPe 2.07