Lineage for d1md8a2 (1md8 A:358-433)

  1. Root: SCOP 1.67
  2. 427008Class g: Small proteins [56992] (72 folds)
  3. 429210Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
    disulfide-rich all-beta fold
  4. 429211Superfamily g.18.1: Complement control module/SCR domain [57535] (1 family) (S)
  5. 429212Family g.18.1.1: Complement control module/SCR domain [57536] (9 proteins)
  6. 429241Protein Complement C1R protease domains [75682] (1 species)
  7. 429242Species Human (Homo sapiens) [TaxId:9606] [75683] (3 PDB entries)
  8. 429243Domain d1md8a2: 1md8 A:358-433 [91246]
    Other proteins in same PDB: d1md8a1

Details for d1md8a2

PDB Entry: 1md8 (more details), 2.8 Å

PDB Description: Monomeric structure of the active catalytic domain of complement protease C1r

SCOP Domain Sequences for d1md8a2:

Sequence, based on SEQRES records: (download)

>d1md8a2 g.18.1.1 (A:358-433) Complement C1R protease domains {Human (Homo sapiens)}
dcgqprnlpngdfrytttmgvntykariqyychepyykmqtragsreseqgvytctaqgi
wkneqkgekiprclpv

Sequence, based on observed residues (ATOM records): (download)

>d1md8a2 g.18.1.1 (A:358-433) Complement C1R protease domains {Human (Homo sapiens)}
dcgqprnlpngdfrytttmgvntykariqyychepyykmqtqgvytctaqgiwkneqkge
kiprclpv

SCOP Domain Coordinates for d1md8a2:

Click to download the PDB-style file with coordinates for d1md8a2.
(The format of our PDB-style files is described here.)

Timeline for d1md8a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1md8a1