Lineage for d1md7a1 (1md7 A:434-685)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1127558Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1127559Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1127765Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)
  6. 1128084Protein Complement C1R protease, catalytic domain [74976] (1 species)
  7. 1128085Species Human (Homo sapiens) [TaxId:9606] [74977] (4 PDB entries)
  8. 1128091Domain d1md7a1: 1md7 A:434-685 [91243]
    Other proteins in same PDB: d1md7a2
    complexed with ndg

Details for d1md7a1

PDB Entry: 1md7 (more details), 3.2 Å

PDB Description: monomeric structure of the zymogen of complement protease c1r
PDB Compounds: (A:) c1r complement serine protease

SCOPe Domain Sequences for d1md7a1:

Sequence, based on SEQRES records: (download)

>d1md7a1 b.47.1.2 (A:434-685) Complement C1R protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
cgkpvnpveqrqriiggqkakmgnfpwqvftnihgrgggallgdrwiltaahtlypkehe
aqsnasldvflghtnveelmklgnhpirrvsvhpdyrqdesynfegdiallelensvtlg
pnllpiclpdndtfydlglmgyvsgfgvmeekiahdlrfvrlpvanpqacenwlrgknrm
dvfsqnmfcaghpslkqdacqgdaggvfavrdpntdrwvatgivswgigcsrgygfytkv
lnyvdwikkeme

Sequence, based on observed residues (ATOM records): (download)

>d1md7a1 b.47.1.2 (A:434-685) Complement C1R protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
cgkpvnpveiiggqkakmgnfpwqvftnihgrgggallgdrwiltaahtlypkeheaqsn
asldvflghtnveelmklgnhpirrvsvhpdyrqdesynfegdiallelensvtlgpnll
piclpdndtfydlglmgyvsgfgahdlrfvrlpvanpqacenwldvfsqnmfcaghpslk
qdacqgdaggvfavrdpntdrwvatgivswgigcsrgygfytkvlnyvdwikkeme

SCOPe Domain Coordinates for d1md7a1:

Click to download the PDB-style file with coordinates for d1md7a1.
(The format of our PDB-style files is described here.)

Timeline for d1md7a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1md7a2