Class b: All beta proteins [48724] (165 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins) |
Protein Complement C1R protease, catalytic domain [74976] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [74977] (3 PDB entries) |
Domain d1md7a1: 1md7 A:434-685 [91243] Other proteins in same PDB: d1md7a2 complexed with nag; mutant |
PDB Entry: 1md7 (more details), 3.2 Å
SCOP Domain Sequences for d1md7a1:
Sequence, based on SEQRES records: (download)
>d1md7a1 b.47.1.2 (A:434-685) Complement C1R protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} cgkpvnpveqrqriiggqkakmgnfpwqvftnihgrgggallgdrwiltaahtlypkehe aqsnasldvflghtnveelmklgnhpirrvsvhpdyrqdesynfegdiallelensvtlg pnllpiclpdndtfydlglmgyvsgfgvmeekiahdlrfvrlpvanpqacenwlrgknrm dvfsqnmfcaghpslkqdacqgdaggvfavrdpntdrwvatgivswgigcsrgygfytkv lnyvdwikkeme
>d1md7a1 b.47.1.2 (A:434-685) Complement C1R protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} cgkpvnpveiiggqkakmgnfpwqvftnihgrgggallgdrwiltaahtlypkeheaqsn asldvflghtnveelmklgnhpirrvsvhpdyrqdesynfegdiallelensvtlgpnll piclpdndtfydlglmgyvsgfgahdlrfvrlpvanpqacenwldvfsqnmfcaghpslk qdacqgdaggvfavrdpntdrwvatgivswgigcsrgygfytkvlnyvdwikkeme
Timeline for d1md7a1: