Lineage for d1m9pb_ (1m9p B:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 349260Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 349261Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 349289Family a.1.1.2: Globins [46463] (20 proteins)
    Heme-binding protein
  6. 349705Protein Hemoglobin, beta-chain [46500] (19 species)
  7. 349759Species Human (Homo sapiens) [TaxId:9606] [46501] (114 PDB entries)
  8. 349933Domain d1m9pb_: 1m9p B: [91238]
    Other proteins in same PDB: d1m9pa_, d1m9pc_

Details for d1m9pb_

PDB Entry: 1m9p (more details), 2.1 Å

PDB Description: Crystalline Human Carbonmonoxy Hemoglobin C Exhibits The R2 Quaternary State at Neutral pH In The Presence of Polyethylene Glycol: The 2.1 Angstrom Resolution Crystal Structure

SCOP Domain Sequences for d1m9pb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m9pb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Human (Homo sapiens)}
vhltpkeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv
kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgk
eftppvqaayqkvvagvanalahkyh

SCOP Domain Coordinates for d1m9pb_:

Click to download the PDB-style file with coordinates for d1m9pb_.
(The format of our PDB-style files is described here.)

Timeline for d1m9pb_: