Class a: All alpha proteins [46456] (290 folds) |
Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) common core: 2 helices, disulfide-linked, and a calcium-binding loop |
Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) |
Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins) automatically mapped to Pfam PF00068 |
Protein Snake phospholipase A2 [48624] (38 species) |
Species King cobra (Ophiophagus hannah), an acidic isoform [TaxId:8665] [101482] (1 PDB entry) |
Domain d1m8tc_: 1m8t C: [91229] complexed with ca, hez |
PDB Entry: 1m8t (more details), 2.1 Å
SCOPe Domain Sequences for d1m8tc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m8tc_ a.133.1.2 (C:) Snake phospholipase A2 {King cobra (Ophiophagus hannah), an acidic isoform [TaxId: 8665]} hlvqfngmirctipgsipwwdysdygcycgsggsgtpvdeldrccqvhdncytqaqqlte cspyskrysydcsegtltckadndecaafvcdcdrvaaicfagapynkeninidtttrc
Timeline for d1m8tc_: