SCOP 1.67: Domain d1m6oa1: 1m6o A:182-276

Lineage for d1m6oa1 (1m6o A:182-276)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88605] (65 PDB entries)

8. Domain d1m6oa1: 1m6o A:182-276 [91189]
   Other proteins in same PDB: d1m6oa2, d1m6ob_

Details for d1m6oa1

PDB Entry: 1m6o, 1.6 Å

PDB Description: Crystal Structure of HLA B*4402 in complex with HLA DPA*0201 peptide

SCOP Domain Sequences for d1m6oa1:

Sequence; same for both SEQRES and ATOM records:

>d1m6oa1 b.1.1.2 (A:182-276) Class I MHC, alpha-3 domain {Human (Homo sapiens)}
adppkthvthhpisdhevtlrcwalgfypaeitltwqrdgedqtqdtelvetrpagdrtf
qkwaavvvpsgeeqrytchvqheglpkpltlrwep

Timeline for d1m6oa1:

• d1m6oa1 is new in SCOP 1.67
  
• d1m6oa1 appears in SCOP 1.69
  
• d1m6oa1 appears in the current release, SCOPe 2.08