Lineage for d1m6oa1 (1m6o A:182-276)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 364354Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 364612Protein Class I MHC, alpha-3 domain [88604] (3 species)
  7. 364613Species Human (Homo sapiens) [TaxId:9606] [88605] (65 PDB entries)
  8. 364618Domain d1m6oa1: 1m6o A:182-276 [91189]
    Other proteins in same PDB: d1m6oa2, d1m6ob_

Details for d1m6oa1

PDB Entry: 1m6o (more details), 1.6 Å

PDB Description: Crystal Structure of HLA B*4402 in complex with HLA DPA*0201 peptide

SCOP Domain Sequences for d1m6oa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m6oa1 b.1.1.2 (A:182-276) Class I MHC, alpha-3 domain {Human (Homo sapiens)}
adppkthvthhpisdhevtlrcwalgfypaeitltwqrdgedqtqdtelvetrpagdrtf
qkwaavvvpsgeeqrytchvqheglpkpltlrwep

SCOP Domain Coordinates for d1m6oa1:

Click to download the PDB-style file with coordinates for d1m6oa1.
(The format of our PDB-style files is described here.)

Timeline for d1m6oa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1m6oa2
View in 3D
Domains from other chains:
(mouse over for more information)
d1m6ob_