Lineage for d1lrwb_ (1lrw B:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 925761Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. 925824Superfamily a.137.2: Methanol dehydrogenase subunit [48666] (1 family) (S)
    consists of single alpha-helix and irregular N-terminal tail
  5. 925825Family a.137.2.1: Methanol dehydrogenase subunit [48667] (2 proteins)
  6. 925826Protein Methanol dehydrogenase, light chain [48668] (3 species)
  7. 925847Species Paracoccus denitrificans [TaxId:266] [101493] (1 PDB entry)
  8. 925848Domain d1lrwb_: 1lrw B: [91112]
    Other proteins in same PDB: d1lrwa_, d1lrwc_
    complexed with ca, pqq

Details for d1lrwb_

PDB Entry: 1lrw (more details), 2.5 Å

PDB Description: Crystal structure of methanol dehydrogenase from P. denitrificans
PDB Compounds: (B:) methanol dehydrogenase subunit 2

SCOPe Domain Sequences for d1lrwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lrwb_ a.137.2.1 (B:) Methanol dehydrogenase, light chain {Paracoccus denitrificans [TaxId: 266]}
ydgtnckapgncwepkpdypakvegskydpqhdpaelskqgeslavmdarnewrvwnmkk
tgkfeydvkkidgydetkappae

SCOPe Domain Coordinates for d1lrwb_:

Click to download the PDB-style file with coordinates for d1lrwb_.
(The format of our PDB-style files is described here.)

Timeline for d1lrwb_: