SCOP 1.75: Domain d1lp9m2: 1lp9 M:118-245

Lineage for d1lp9m2 (1lp9 M:118-245)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein T-cell antigen receptor [49125] (6 species)

7. Species Mouse (Mus musculus), beta-chain [TaxId:10090] [49128] (15 PDB entries)

8. Domain d1lp9m2: 1lp9 M:118-245 [91096]
   Other proteins in same PDB: d1lp9a1, d1lp9a2, d1lp9b_, d1lp9e1, d1lp9f1, d1lp9h1, d1lp9h2, d1lp9i_, d1lp9l1, d1lp9m1

Details for d1lp9m2

PDB Entry: 1lp9, 2 Å

PDB Description: xenoreactive complex ahiii 12.2 tcr bound to p1049/hla-a2.1

PDB Compounds: (M:) T-cell receptor beta chain

SCOP Domain Sequences for d1lp9m2:

Sequence; same for both SEQRES and ATOM records:

>d1lp9m2 b.1.1.2 (M:118-245) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]}
dlrnvtppkvslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvstdpq
aykesnysyalssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaea
wgra

Timeline for d1lp9m2:

• d1lp9m2 first appeared in SCOP 1.67
  
• d1lp9m2 appears in SCOP 1.73
  
• d1lp9m2 appears in SCOPe 2.01
  
• d1lp9m2 appears in the current release, SCOPe 2.08