SCOP 1.69: Domain d1lp9l1: 1lp9 L:0-117

Lineage for d1lp9l1 (1lp9 L:0-117)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)

6. Protein T-cell antigen receptor [48933] (6 species)
   sequences may differ within each classified species

7. Species Mouse (Mus musculus), alpha-chain [TaxId:10090] [48934] (16 PDB entries)

8. Domain d1lp9l1: 1lp9 L:0-117 [91093]
   Other proteins in same PDB: d1lp9a1, d1lp9a2, d1lp9b_, d1lp9e2, d1lp9f2, d1lp9h1, d1lp9h2, d1lp9i_, d1lp9l2, d1lp9m2

Details for d1lp9l1

PDB Entry: 1lp9, 2 Å

PDB Description: xenoreactive complex ahiii 12.2 tcr bound to p1049/hla-a2.1

SCOP Domain Sequences for d1lp9l1:

Sequence; same for both SEQRES and ATOM records:

>d1lp9l1 b.1.1.1 (L:0-117) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain}
mdsvtqteglvtlteglpvmlnctyqstyspflfwyvqhlneapklllksftdnkrpehq
gfhatlhkssssfhlqkssaqlsdsalyycalflasssfsklvfgqgtslsvvpn

Timeline for d1lp9l1:

• d1lp9l1 first appeared in SCOP 1.67
  
• d1lp9l1 appears in SCOP 1.71
  
• d1lp9l1 appears in the current release, SCOPe 2.08