Lineage for d1lp9f2 (1lp9 F:118-245)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 656668Protein T-cell antigen receptor [49125] (6 species)
  7. 656726Species Mouse (Mus musculus), beta-chain [TaxId:10090] [49128] (11 PDB entries)
  8. 656728Domain d1lp9f2: 1lp9 F:118-245 [91089]
    Other proteins in same PDB: d1lp9a1, d1lp9a2, d1lp9b_, d1lp9e1, d1lp9f1, d1lp9h1, d1lp9h2, d1lp9i_, d1lp9l1, d1lp9m1

Details for d1lp9f2

PDB Entry: 1lp9 (more details), 2 Å

PDB Description: Xenoreactive complex AHIII 12.2 TCR bound to p1049/HLA-A2.1
PDB Compounds: (F:) T-cell receptor beta chain

SCOP Domain Sequences for d1lp9f2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lp9f2 b.1.1.2 (F:118-245) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]}
dlrnvtppkvslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvstdpq
aykesnysyalssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaea
wgra

SCOP Domain Coordinates for d1lp9f2:

Click to download the PDB-style file with coordinates for d1lp9f2.
(The format of our PDB-style files is described here.)

Timeline for d1lp9f2: