Lineage for d1llud2 (1llu D:144-309)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2841006Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (19 proteins)
    N-terminal all-beta domain defines family
  6. 2841027Protein Alcohol dehydrogenase [51737] (9 species)
  7. 2841224Species Pseudomonas aeruginosa [TaxId:287] [102122] (1 PDB entry)
  8. 2841228Domain d1llud2: 1llu D:144-309 [91071]
    Other proteins in same PDB: d1llua1, d1llub1, d1lluc1, d1llud1, d1llue1, d1lluf1, d1llug1, d1lluh1
    complexed with edo, nad, zn

Details for d1llud2

PDB Entry: 1llu (more details), 2.3 Å

PDB Description: the ternary complex of pseudomonas aeruginosa alcohol dehydrogenase with its coenzyme and weak substrate
PDB Compounds: (D:) alcohol dehydrogenase

SCOPe Domain Sequences for d1llud2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1llud2 c.2.1.1 (D:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]}
vefaeiapilcagvtvykglkqtnarpgqwvaisgigglghvavqyaramglhvaaidid
daklelarklgasltvnarqedpveaiqrdiggahgvlvtavsnsafgqaigmarrggti
alvglppgdfptpifdvvlkglhiagsivgtradlqealdfagegl

SCOPe Domain Coordinates for d1llud2:

Click to download the PDB-style file with coordinates for d1llud2.
(The format of our PDB-style files is described here.)

Timeline for d1llud2: