Lineage for d1l2gd_ (1l2g D:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 781544Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)
  6. 781733Protein HSV glycoprotein D [63637] (1 species)
  7. 781734Species Herpes simplex virus type 1 [TaxId:10298] [63638] (2 PDB entries)
    elaborated with insertions and N- and C-terminal extensions
  8. 781739Domain d1l2gd_: 1l2g D: [91051]
    complexed with nag

Details for d1l2gd_

PDB Entry: 1l2g (more details), 2.85 Å

PDB Description: structure of a c-terminally truncated form of glycoprotein d from hsv- 1
PDB Compounds: (D:) glycoprotein d

SCOP Domain Sequences for d1l2gd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l2gd_ b.1.1.1 (D:) HSV glycoprotein D {Herpes simplex virus type 1 [TaxId: 10298]}
pnrfrgkdlpvldqltdppgvrrvyhiqaglpdpfqppslpitvyyavleracrsvllna
pseapqivrgasedvrkqpynltiawfrmggncaipitvmeytecsynkslgacpirtqp
rwnyydsfsavsednlgflmhapafetagtylrlvkindwteitqfilehrakgsckyal
plrippsaclspqayqqgvtvdsigmlprfipenqrtvavyslkiagwhgpkapytstll
pp

SCOP Domain Coordinates for d1l2gd_:

Click to download the PDB-style file with coordinates for d1l2gd_.
(The format of our PDB-style files is described here.)

Timeline for d1l2gd_: