Lineage for d1ku6a_ (1ku6 A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1178944Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1178945Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1178946Family c.69.1.1: Acetylcholinesterase-like [53475] (6 proteins)
  6. 1178947Protein Acetylcholinesterase [53476] (5 species)
  7. 1178971Species Mouse (Mus musculus) [TaxId:10090] [53479] (16 PDB entries)
  8. 1178996Domain d1ku6a_: 1ku6 A: [91037]
    Other proteins in same PDB: d1ku6b_
    complexed with edo, nag

Details for d1ku6a_

PDB Entry: 1ku6 (more details), 2.5 Å

PDB Description: Fasciculin 2-Mouse Acetylcholinesterase Complex
PDB Compounds: (A:) acetylcholinesterase

SCOPe Domain Sequences for d1ku6a_:

Sequence, based on SEQRES records: (download)

>d1ku6a_ c.69.1.1 (A:) Acetylcholinesterase {Mouse (Mus musculus) [TaxId: 10090]}
redpqllvrvrggqlrgirlkapggpvsaflgipfaeppvgsrrfmppepkrpwsgvlda
ttfqnvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprpasptpvliwiyggg
fysgaasldvydgrflaqvegavlvsmnyrvgtfgflalpgsreapgnvglldqrlalqw
vqeniaafggdpmsvtlfgesagaasvgmhilslpsrslfhravlqsgtpngpwatvsag
earrratllarlvgcppggaggndteliaclrtrpaqdlvdhewhvlpqesifrfsfvpv
vdgdflsdtpealintgdfqdlqvlvgvvkdegsyflvygvpgfskdneslisraqflag
vrigvpqasdlaaeavvlhytdwlhpedpthlrdamsavvgdhnvvcpvaqlagrlaaqg
arvyayifehrastltwplwmgvphgyeiefifglpldpslnytteerifaqrlmkywtn
fartgdpndprdskspqwppyttaaqqyvslnlkplevrrglraqtcafwnrflpklls

Sequence, based on observed residues (ATOM records): (download)

>d1ku6a_ c.69.1.1 (A:) Acetylcholinesterase {Mouse (Mus musculus) [TaxId: 10090]}
redpqllvrvrggqlrgirlkapggpvsaflgipfaeppvgsrrfmppepkrpwsgvlda
ttfqnvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprpasptpvliwiyggg
fysgaasldvydgrflaqvegavlvsmnyrvgtfgflalpgsreapgnvglldqrlalqw
vqeniaafggdpmsvtlfgesagaasvgmhilslpsrslfhravlqsgtpngpwatvsag
earrratllarlvgcpggndteliaclrtrpaqdlvdhewhvlpqesifrfsfvpvvdgd
flsdtpealintgdfqdlqvlvgvvkdegsyflvygvpgfskdneslisraqflagvrig
vpqasdlaaeavvlhytdwlhpedpthlrdamsavvgdhnvvcpvaqlagrlaaqgarvy
ayifehrastltwplwmgvphgyeiefifglpldpslnytteerifaqrlmkywtnfart
gdpndprdskspqwppyttaaqqyvslnlkplevrrglraqtcafwnrflpklls

SCOPe Domain Coordinates for d1ku6a_:

Click to download the PDB-style file with coordinates for d1ku6a_.
(The format of our PDB-style files is described here.)

Timeline for d1ku6a_: