| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.11: EF-G C-terminal domain-like [54980] (4 families) ![]() |
| Family d.58.11.1: EF-G/eEF-2 domains III and V [54981] (5 proteins) domain III structure is lacking some of the superfamily characters and is often disordered in crystals |
| Protein Elongation factor G (EF-G) [54982] (2 species) domain III is seen in 1FNM but disordered in the most of other PDB entries |
| Species Thermus thermophilus [TaxId:274] [54983] (9 PDB entries) |
| Domain d1ktvb4: 1ktv B:600-689 [91034] Other proteins in same PDB: d1ktva1, d1ktva2, d1ktva3, d1ktvb1, d1ktvb2, d1ktvb3 |
PDB Entry: 1ktv (more details), 3.8 Å
SCOPe Domain Sequences for d1ktvb4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ktvb4 d.58.11.1 (B:600-689) Elongation factor G (EF-G) {Thermus thermophilus [TaxId: 274]}
vilepimrvevttpeeymgdvigdlnarrgqilgmeprgnaqvirafvplaemfgyatdl
rsktqgrgsfvmffdhyqevpkqvqeklik
Timeline for d1ktvb4:
View in 3DDomains from other chains: (mouse over for more information) d1ktva1, d1ktva2, d1ktva3, d1ktva4 |