SCOP 1.71: Domain d1ktvb1: 1ktv B:283-399

Lineage for d1ktvb1 (1ktv B:283-399)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.3: Translation proteins [50447] (3 families)

5. Family b.43.3.1: Elongation factors [50448] (9 proteins)

6. Protein Elongation factor G (EF-G), domain II [50456] (1 species)

7. Species Thermus thermophilus [TaxId:274] [50457] (6 PDB entries)

8. Domain d1ktvb1: 1ktv B:283-399 [91031]
   Other proteins in same PDB: d1ktva2, d1ktva3, d1ktva4, d1ktvb2, d1ktvb3, d1ktvb4

Details for d1ktvb1

PDB Entry: 1ktv, 3.8 Å

PDB Description: crystal structure of elongation factor g dimer without nucleotide

SCOP Domain Sequences for d1ktvb1:

Sequence; same for both SEQRES and ATOM records:

>d1ktvb1 b.43.3.1 (B:283-399) Elongation factor G (EF-G), domain II {Thermus thermophilus}
pldippikgttpegevveihpdpngplaalafkimadpyvgrltfirvysgtltsgsyvy
nttkgrkervarllrmhanhreeveelkagdlgavvglketitgdtlvgedaprvil

Timeline for d1ktvb1:

• d1ktvb1 first appeared in SCOP 1.67
  
• d1ktvb1 appears in SCOP 1.69
  
• d1ktvb1 appears in SCOP 1.73
  
• d1ktvb1 appears in the current release, SCOPe 2.08