Lineage for d1ktva4 (1ktv A:600-689)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 724976Superfamily d.58.11: EF-G C-terminal domain-like [54980] (3 families) (S)
  5. 724977Family d.58.11.1: EF-G/eEF-2 domains III and V [54981] (2 proteins)
    domain III structure is lacking some of the superfamily characters and is often disordered in crystals
  6. 725026Protein Elongation factor G (EF-G) [54982] (2 species)
    domain III is seen in 1FNM but disordered in the most of other PDB entries
  7. 725027Species Thermus thermophilus [TaxId:274] [54983] (9 PDB entries)
  8. 725040Domain d1ktva4: 1ktv A:600-689 [91030]
    Other proteins in same PDB: d1ktva1, d1ktva2, d1ktva3, d1ktvb1, d1ktvb2, d1ktvb3

Details for d1ktva4

PDB Entry: 1ktv (more details), 3.8 Å

PDB Description: crystal structure of elongation factor g dimer without nucleotide
PDB Compounds: (A:) Elongation factor G

SCOP Domain Sequences for d1ktva4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ktva4 d.58.11.1 (A:600-689) Elongation factor G (EF-G) {Thermus thermophilus [TaxId: 274]}
vilepimrvevttpeeymgdvigdlnarrgqilgmeprgnaqvirafvplaemfgyatdl
rsktqgrgsfvmffdhyqevpkqvqeklik

SCOP Domain Coordinates for d1ktva4:

Click to download the PDB-style file with coordinates for d1ktva4.
(The format of our PDB-style files is described here.)

Timeline for d1ktva4: