Lineage for d1ktva1 (1ktv A:283-399)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 464636Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 464647Superfamily b.43.3: Translation proteins [50447] (2 families) (S)
  5. 464648Family b.43.3.1: Elongation factors [50448] (8 proteins)
  6. 464666Protein Elongation factor G (EF-G), domain II [50456] (1 species)
  7. 464667Species Thermus thermophilus [TaxId:274] [50457] (6 PDB entries)
  8. 464673Domain d1ktva1: 1ktv A:283-399 [91027]
    Other proteins in same PDB: d1ktva2, d1ktva3, d1ktva4, d1ktvb2, d1ktvb3, d1ktvb4

Details for d1ktva1

PDB Entry: 1ktv (more details), 3.8 Å

PDB Description: crystal structure of elongation factor g dimer without nucleotide

SCOP Domain Sequences for d1ktva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ktva1 b.43.3.1 (A:283-399) Elongation factor G (EF-G), domain II {Thermus thermophilus}
pldippikgttpegevveihpdpngplaalafkimadpyvgrltfirvysgtltsgsyvy
nttkgrkervarllrmhanhreeveelkagdlgavvglketitgdtlvgedaprvil

SCOP Domain Coordinates for d1ktva1:

Click to download the PDB-style file with coordinates for d1ktva1.
(The format of our PDB-style files is described here.)

Timeline for d1ktva1: