Lineage for d1kpot1 (1kpo T:2-136,T:410-526)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 777516Fold a.129: GroEL equatorial domain-like [48591] (1 superfamily)
    multihelical; 8 helices arranged in 2 parallel layers
  4. 777517Superfamily a.129.1: GroEL equatorial domain-like [48592] (2 families) (S)
    duplication: two 4-helical subdomains are related by a pseudo dyad passing through the ATP-binding site
  5. 777518Family a.129.1.1: GroEL chaperone, ATPase domain [48593] (1 protein)
  6. 777519Protein GroEL, E domain [48594] (4 species)
  7. 777520Species Escherichia coli [TaxId:562] [48595] (9 PDB entries)
  8. 777619Domain d1kpot1: 1kpo T:2-136,T:410-526 [90997]
    Other proteins in same PDB: d1kpo12, d1kpo13, d1kpo22, d1kpo23, d1kpoo2, d1kpoo3, d1kpop2, d1kpop3, d1kpoq2, d1kpoq3, d1kpor2, d1kpor3, d1kpos2, d1kpos3, d1kpot2, d1kpot3, d1kpou2, d1kpou3, d1kpov2, d1kpov3, d1kpow2, d1kpow3, d1kpox2, d1kpox3, d1kpoy2, d1kpoy3, d1kpoz2, d1kpoz3

Details for d1kpot1

PDB Entry: 1kpo (more details), 3.52 Å

PDB Description: Structural and mechanistic basis for allostery in the bacterial chaperonin GroEL; see remark 400
PDB Compounds: (T:) groEL protein

SCOP Domain Sequences for d1kpot1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kpot1 a.129.1.1 (T:2-136,T:410-526) GroEL, E domain {Escherichia coli [TaxId: 562]}
aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
kavtaaveelkalsvXgvvagggvalirvaskladlrgqnadqnvgikvalrameaplrq
ivlncgeepsvvantvkggdgnygynaateeygnmidmgildptkvtrsalqyaasvagl
mittecmvtdlpk

SCOP Domain Coordinates for d1kpot1:

Click to download the PDB-style file with coordinates for d1kpot1.
(The format of our PDB-style files is described here.)

Timeline for d1kpot1: